PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G395600.1.p
Common NameSb02g041070, SORBIDRAFT_02g041070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 571aa    MW: 60675.6 Da    PI: 5.8403
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G395600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.29.7e-15115175363
                           XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  Sobic.002G395600.1.p 115 EAKRRARLVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSARISCVTAENAALKQQL 175
                           78********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-13112177IPR004827Basic-leucine zipper domain
PfamPF001704.0E-13115175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151115175IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.56E-13117175No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-16117175No hitNo description
CDDcd147041.14E-21118169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MAEPALLAPD PFADLPFPEF QAPVDGDTFA FEDFDLEDLD LDLDVDFDLD LFASDGQLSQ  60
PPPLATSSSS AGSPEGGSSS SGGGGGLRNE ESSESSSRSA SGTDGSDKGK GEDDEAKRRA  120
RLVRNRESAH LSRQRKKQYV EELEGKVKAM QATIADLSAR ISCVTAENAA LKQQLGGAAG  180
AAPPLPMPMY PAMYPLPMPW MHPAYPMRGS QVPLVPIPRL KPQQPAPTAA EPPAKKARKT  240
KKVASVSFLG LLCLAMLCGC LISVVHRMYP SVDAGEGAAF GPSHHGRILA VEGPHDNVSD  300
GIDPKPPQSG SETLPALLYL PKNGKHVKIN GNLVIKSIVA SEKASLRLPG YDGTSPQKQK  360
KEETSLAIPG YVTPLEAGEV MESAKGVMKN ELMALAPADG NVYREEDGLL PQWFSEAMSG  420
PLLSSGMCTE VFQFDASPSS AHSNGIIPVY SNTMSNSSQN FTQKLPSACP RTVKNRRISY  480
SETIPLRGST SNDTEHFKTP PKNESFGSTK PVSSVVVSVL ADPREAGDGD GEGRISSKSL  540
SRIFVVVLID SVKYVTYSCV LPFKSHSPHL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.119740.0embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9739380.0EU973938.1 Zea mays clone 424664 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLC5X3Z40.0C5X3Z4_SORBI; Putative uncharacterized protein Sb02g041070
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.18e-63basic region/leucine zipper motif protein 49